PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G09735.1
Common NameF11F8.8, S1FA3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family S1Fa-like
Protein Properties Length: 73aa    MW: 8070.81 Da    PI: 10.7779
Description S1FA-like DNA-binding protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G09735.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA147.42.5e-46573270
         S1FA  2 avakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                 +++k+e+kGlnPGlivllv+gglll+flvgn+ily+yaqknlPPrkkkPvskkk+k+ek+kqGv+vPGe
  AT3G09735.1  5 FDGKIESKGLNPGLIVLLVIGGLLLTFLVGNFILYTYAQKNLPPRKKKPVSKKKMKKEKMKQGVQVPGE 73
                 6889****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046891.3E-40973IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 73 aa     Download sequence    Send to blast
MAAEFDGKIE SKGLNPGLIV LLVIGGLLLT FLVGNFILYT YAQKNLPPRK KKPVSKKKMK  60
KEKMKQGVQV PGE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.191001e-123flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453383101e-123
Genevisible258713_at6e-96
Expression AtlasAT3G09735-
AtGenExpressAT3G09735-
ATTED-IIAT3G09735-
Functional Description ? help Back to Top
Source Description
UniProtDNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00339DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G09735.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G09735
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3806291e-121AF380629.1 Arabidopsis thaliana AT3g09731 mRNA, complete cds.
GenBankAK1189701e-121AK118970.1 Arabidopsis thaliana At3g09735 mRNA for unknown protein, complete cds, clone: RAFL21-30-H15.
GenBankAY0541291e-121AY054129.1 Arabidopsis thaliana AT3g09731 mRNA, complete cds.
GenBankAY0871861e-121AY087186.1 Arabidopsis thaliana clone 32612 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_566353.11e-44DNA-binding protein S1FA3
SwissprotQ93VI01e-46S1FA3_ARATH; DNA-binding protein S1FA3
TrEMBLA0A087H8A92e-27A0A087H8A9_ARAAL; Uncharacterized protein
STRINGAT3G09735.13e-44(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28232769
Representative plantOGRP50951322
Publications ? help Back to Top
  1. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  2. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]